Creme Of Nature Pure Honey Hair Mask 11.5OzOut of stock
Crème of Nature

Creme Of Nature Pure Honey Hair Mask 11.5Oz

BHD 7.20
Out of StockBHBH
Size (1 variants)

11.5oz

SKU: 075724428027

BHD 7.20

Out of stock

View Now

Description

Replenish moisture, prevent breakage, and tame and control frizz with this Moisture Replenish & Strength Hair Mask infused with Pure Honey, Certified Natural Coconut Oil and Shea Butter. BENEFITS Replenishes Moisture Strengthens & Helps to Prevent Breakage Super Slip Detangler Tames & Controls Frizz NO Sulfates* NO Mineral Oil* How to Use: After using the Dry Defense Shampoo, evenly apply a generous amount to clean, wet hair from roots to ends, concentrating on dry or damaged areas. Leave on for 5-10 minutes and rinse thoroughly. For rapid restoration, after applying mask proceed with hair steaming or sit under a hooded dryer with a plastic cap. Use weekly for best results Ingredients: Aqua/Water/Eau, Cetearyl Alcohol, Behentrimonium Chloride, Hydroxypropyl Starch Phosphate, Dicetyldimonium Chloride, Parfum (Fragrance), Butyrospermum Parkii (Shea) Butter, Cetyl Alcohol, Cocos Nucifera (Coconut) Oil, Dicaprylyl Carbonate, Dimethicone, Dimethiconol, Hydrolyzed Milk Protein, Hydroxyethylcellulose, Lauric Acid, Lauryl Alcohol Diphosphonic Acid, Lauryl Glucoside, Mel (Honey (Miel)), Olea Europaea (Olive) Fruit Oil, Panthenol, Pentylene Glycol, Polyquaternium- 37, Propylene Glycol, Quaternium-70, Sodium Acetate, Benzophenone-3, Disodium EDTA, Isopropyl Alcohol, Lactic Acid, Phenoxyethanol, Sodium Benzoate, Blue 1 (CI 42090), Caramel, Red 4 (CI 14700), Yellow 6 (CI 15985) .F00203

Product Information

BrandCrème of Nature
CategoryHair Mask
MPN / SKU075724428027
Item Group6783823577246
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI