Nittoh Royal Milk Tea MatchaOut of stock
Mitsui Norin Co. Ltd.

Nittoh Royal Milk Tea Matcha

$4.19
Out of StockUSUS
Title (1 variants)

Default Title

SKU: 4902831511945

$4.19

In stock

View Now

Description

Nittoh Royal Milk Tea Matcha is an Instant individually packaged stick type Royal Milk Tea Matcha. It is an instant Royal Milk Tea Matcha that is easily dissolved in hot water so you can enjoy the Rich Mellow Taste and Elegant Aroma at home, work or anywhere. Nittoh Royal Milk Tea Matcha brings together the luxurious creaminess of Royal Milk Tea and the refined depth of authentic Japanese matcha—all in a convenient instant stick. Made with 100% premium Uji matcha, this Royal Milk Tea Matcha delivers a highly fragrant aroma and a naturally rich, mellow matcha flavor. The gentle bitterness of Uji matcha is perfectly balanced with just the right touch of sweetness, while whole milk powder from Hokkaido adds a velvety smoothness and satisfying richness. Simply add hot water and watch it dissolve effortlessly, releasing an elegant aroma and creating a comforting cup with a smooth, indulgent taste. Each sip offers the creamy warmth of Royal Milk Tea paired with the earthy sophistication of matcha—ideal for moments when you want to unwind and relax. Individually wrapped stick packs ensure lasting freshness and make it easy to enjoy anytime, anywhere—at home, at the office, or on the go. A simple yet indulgent way to enjoy authentic Royal Milk Tea Matcha whenever the mood strikes. Instructions: ( How to Brew). Just by putting one stick in a cup and pouring hot water, you can easily enjoy an authentic Nittoh Royal Milk Tea Matcha anytime. Hot : Pour one stick in a cup of hot water (120ml), stir well and enjoy. Iced : Pour 1 stick into Cold Water (120ml). Add several pieces of ice and stir well until it becomes cold. (For a Creamy Milk Tea use Milk or Soy Milk instead of Water). Nutrition: Per cup (13g): Energy 54kcal, Protein: 0.8g, Lipid: 0.9g, Carbohydrate: 10.8g, Salt equivalent: 0.04g, Caffeine 0.02. Ingredients: Sugar Prepared product (sugar, dextrin) (Made in Korea), Skim milk powder prepared product (skim milk powder, sugar, dextrin), Milk-based food products (lactose

Product Information

BrandMitsui Norin Co. Ltd.
CategoryJapanese Green Tea
MPN / SKU4902831511945
Item Group7882665754672
CurrencyUSD
CountryUS

Ships to (235 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO