(UCC) The Blend 114 Instant Coffee (Bag)Out of stock
Ueshima Coffee Co. Ltd

(UCC) The Blend 114 Instant Coffee (Bag)

$12.88
Out of StockUSUS
Title (1 variants)

Default Title

SKU: 4901201103872

$12.88

In stock

View Now

Description

UCC The Blend 114 Instant Coffee is a package (bag) of premium quality instant coffee from UCC Ueshima Coffee. UCC The Blend 114 Instant Coffee, an exceptional blend meticulously crafted by UCC Ueshima Coffee since its inception in 1988. Carefully curated from a selection of 500 varieties, Blend 114 represents the pinnacle of our dedication and innovation in coffee blending. Crafted with precision and expertise, this premium instant coffee embodies the essence of UCC's commitment to quality. Our unique blending technology ensures that only the finest raw materials, meticulously assessed by coffee connoisseurs, make their way into each batch. Delight your senses with the sweet aroma and velvety smoothness of Blend 114. Sourced from the choicest coffee beans from Brazil and Papua New Guinea, every sip offers a symphony of flavors that captivate the palate. Experience the legacy of excellence with UCC The Blend 114 Instant Coffee — a testament to our unwavering pursuit of perfection in every cup. Bitterness: ★★★☆☆ Acidity: ★★☆☆☆ Richness: ★★★☆☆ Instructions: ( How to Brew). Just by putting The Blend 114 Instant Coffee in a cup and pouring hot water, you can easily enjoy a fresh brewed cup of Coffee anytime. Hot: Put one heaping teaspoon (2 grams) in hot water (140-180ml). Stir gently until coffee is dissolved in water. Iced: Put one heaping teaspoon (2 Grams) in hot water (70-90ml). Add 5-6 ice cubes and stir gently until cold. Nutrition: (Serving Size 2g), Calorie : 6kcal, protein : 0.3g, Lipid : 0g, carbohydrate : 1.1g, Salt equivalent : 0.003g. Ingredients: Coffee Beans. (Brazil and Papua New Guinea, etc) . Manufacturer: UCC Ueshima Coffee Co., Ltd. 7-7-7 Minatojima Nakamachi, Chuo-ku, Kobe. Manufacturing Factory: 3-1-3 Tsujiko, Takatsuki City, Osaka Prefecture, Japan. Size: Height: 14.5 cm. Width: 7 cm. Depth: 6 cm. Weight: 180 grams. Disclaimer: Japanese Green Tea Shops strives to display the latest product information on our site, but the product specifications (

Product Information

BrandUeshima Coffee Co. Ltd
CategoryInstant Coffee
MPN / SKU4901201103872
Item Group7355392458800
CurrencyUSD
CountryUS

Ships to (235 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO