Sugar Skull German Shepherd Leggings
GearBunch

Sugar Skull German Shepherd Leggings

$88.99
In StockAUAU
Size (5 variants)

XS

Color: Purple

SKU: 3953503

$88.99

In stock

S

Color: Purple

SKU: 3854161

$88.99

In stock

M

Color: Purple

SKU: 3787150

$88.99

In stock

L

Color: Purple

SKU: 1337770

$88.99

In stock

XL

Color: Purple

SKU: 4769178

$88.99

In stock

View Now

Description

Showcase your love for both canine companionship and captivating art with these Sugar Skull German Shepherd Leggings. This unique design blends the iconic sugar skull motif with the playful energy of German Shepherds. These leggings are perfect for expressing your unique style during workouts, yoga sessions, or everyday adventures. Why You'll Love It The vibrant print wraps around the entire leg for a truly eye-catching look. Full-length coverage provides a flattering silhouette and comfortable feel. Designed for versatility, perfect for yoga, gym sessions, running errands, or lounging at home. Features a squat-proof fabric that offers confidence and ensures no show-through during your workouts. The buttery-soft fabric feels like a second skin, providing ultimate comfort all day long. A comfortable, high waistband stays in place and won't roll down, offering a secure fit. The four-way stretch material allows for a full range of motion, maximizing your flexibility. Easy care: Machine wash cold, tumble dry low. You Might Also Like Yellow Ornamental Skull Capris Pink X-ray Skeleton Leggings Colorful Dead - Sugar Skull Yoga Shorts

Product Information

BrandGearBunch
CategoryLeggings
MPN / SKU3953503
Item Group11960803795
CurrencyUSD
CountryAU

Ships to (209 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBLBLBMBMBNBNBQBQBRBRBSBSBTBTBVBVBYBYBZBZCACACCCCCDCDCFCFCHCHCICICKCKCLCLCMCMCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGNGNGPGPGQGQGRGRGSGSGTGTGYGYHKHKHMHMHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOISISITITJEJEJMJMJOJOJPJPKEKEKHKH
Sugar Skull German Shepherd Leggings — Bobby